PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009140894.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 299aa    MW: 32936.8 Da    PI: 5.2553
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009140894.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.12.4e-18228262135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C ttkTp+WR+gp g+ktLCnaCG+++r+ +l
  XP_009140894.1 228 CTHCETTKTPQWREGPCGPKTLCNACGVRFRSGRL 262
                     *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.9E-16222272IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.2E-14226259IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.49226258IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.66E-14226285No hitNo description
PfamPF003204.0E-16228262IPR000679Zinc finger, GATA-type
CDDcd002022.71E-14228264No hitNo description
PROSITE patternPS003440228253IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MLSSCNARFV ALSLSLTLSS SGCGQMNNGG SWLPEEEEEL KGLSENFFDD LITLPLEEDM  60
ETGDDDEEGD WDAKFENLVP PPLDLLTSLS SEFTHAPRAG LLRNPLPTLK QSSSSEVSSS  120
SLPDVKLSTL FQSSSALSVL ENAAAANGSV SFPVKGTRSN LRKRPTPPTF RSLKSFASEM  180
VQQFAPDDPD SETYLPFAKK KRQRKNKDQS SVSDSPEQFN ADGTIRMCTH CETTKTPQWR  240
EGPCGPKTLC NACGVRFRSG RLLPEYRPSS SPSFIPSLHS NSHRKIIEMR RKDQDLQPG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1198203KKKRQR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140895.10.0PREDICTED: GATA transcription factor 11-like isoform X1
RefseqXP_009140894.10.0PREDICTED: GATA transcription factor 11-like isoform X1
SwissprotQ6DBP81e-84GAT11_ARATH; GATA transcription factor 11
TrEMBLM4F3Q81e-180M4F3Q8_BRARP; Uncharacterized protein
STRINGBra035708.1-P1e-180(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-54GATA transcription factor 11